PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G200400.1
Common NamePHAVU_006G200400g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family M-type_MADS
Protein Properties Length: 83aa    MW: 9367.91 Da    PI: 11.1473
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G200400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.91.4e-281059251
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        ri+n++ rqvtfskRrng+lKKA ELS+LCdaev +++fsstgkly+y+s
  Phvul.006G200400.1 10 RIDNSTSRQVTFSKRRNGLLKKARELSILCDAEVGLMVFSSTGKLYDYAS 59
                        8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.945161IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.97E-29263IPR002100Transcription factor, MADS-box
CDDcd002652.83E-39262No hitNo description
PRINTSPR004047.6E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003194.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004047.6E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MGRGKIAIRR IDNSTSRQVT FSKRRNGLLK KARELSILCD AEVGLMVFSS TGKLYDYAST  60
RTWLQLFWKK TGLEPLSSHS LF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D8e-20260159Myocyte-specific enhancer factor 2A
3mu6_C8e-20260159Myocyte-specific enhancer factor 2A
3mu6_B8e-20260159Myocyte-specific enhancer factor 2A
3mu6_A8e-20260159Myocyte-specific enhancer factor 2A
1egw_D8e-20260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C8e-20260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B8e-20260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A8e-20260159MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-19260159Myocyte-specific enhancer factor 2A
3p57_I1e-19260159Myocyte-specific enhancer factor 2A
3p57_D1e-19260159Myocyte-specific enhancer factor 2A
3p57_C1e-19260159Myocyte-specific enhancer factor 2A
3p57_B1e-19260159Myocyte-specific enhancer factor 2A
3p57_A1e-19260159Myocyte-specific enhancer factor 2A
3kov_J1e-19260159Myocyte-specific enhancer factor 2A
3kov_I1e-19260159Myocyte-specific enhancer factor 2A
3kov_B1e-19260159Myocyte-specific enhancer factor 2A
3kov_A1e-19260159Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0968102e-87BT096810.1 Soybean clone JCVI-FLGm-25F18 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148344.11e-54hypothetical protein PHAVU_006G200400g
SwissprotQ9SI382e-33ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLV7BTH41e-54V7BTH4_PHAVU; Uncharacterized protein
STRINGGLYMA15G06470.15e-37(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.11e-34AGAMOUS-like 44